PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009761907.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 220aa    MW: 25156.7 Da    PI: 9.822
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009761907.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.29.9e-2751139190
            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     ++YneYA+++GFsvrk++ + +k+ g +t+++++C keg+r ++k+k  +++++++etrt C+a+++v++e+  k+++tk+eleHnH+l+
  XP_009761907.1  51 NYYNEYARRIGFSVRKEYVNINKKLGYVTSQKLTCFKEGFRGDDKRK-YQAKNPQKETRTRCQAHIVVTRESVRKYHITKVELEHNHPLV 139
                     69******************************************999.9***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.0E-2451139IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MPFELSSQLP NKPSTLLAVV ICVSIYVNSV RSIDREPALG LEFDDDESAF NYYNEYARRI  60
GFSVRKEYVN INKKLGYVTS QKLTCFKEGF RGDDKRKYQA KNPQKETRTR CQAHIVVTRE  120
SVRKYHITKV ELEHNHPLVS STMIHMLPSH RNLNDVQTHE IDLAEDAGLF SKGTFDFMSL  180
QAGGRANLGY TKLNHKNYLR TKRQKAMGQG EAGKLLVQIA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009761907.11e-166PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30211740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-28FAR1-related sequence 5